PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000787808
Common NameMdMYBB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 252aa    MW: 28452.5 Da    PI: 4.8389
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000787808genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+    +G  +W+++++  g++R++k+c++rw +yl
    MDP0000787808 14 KGPWTAEEDKKLVNFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.45.3e-1673111747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
    MDP0000787808  73 AEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      69**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.309961IPR017930Myb domain
SuperFamilySSF466891.31E-2611108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002492.2E-151461IPR001005SANT/Myb domain
CDDcd001677.40E-101661No hitNo description
PROSITE profilePS5129426.28762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2463117IPR009057Homeodomain-like
SMARTSM007174.6E-1466114IPR001005SANT/Myb domain
PfamPF002493.9E-1473111IPR001005SANT/Myb domain
CDDcd001676.33E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLVNFLL THGQCCWRAV PKLAGLRRCG KSCRLRWINY  60
LRPDLKRGLL NDAEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLVKMG  120
IDPITHEPLH KQVTTXQEMP CEASNQPANS DMSIQQMNTN IPEHGISTNS DGNSTSENSP  180
SNDSEPAEPN PNYSEEEDPL VSFILSDTFL EDLTWDFSTS SEYSSADNPT EENSLAWFMD  240
CNDFGVEDFE L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159930.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3702300.0AB370230.1 Malus x domestica MdMYBB mRNA for myb-related transcription factor, complete cds.
GenBankDQ0744670.0DQ074467.1 Malus x domestica MYB19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376253.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX68e-95ODO1_PETHY; Protein ODORANT1
TrEMBLQ2LME50.0Q2LME5_MALDO; MYB19
STRINGPOPTR_0015s14600.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.12e-90myb domain protein 42
Publications ? help Back to Top
  1. Hellens RP, et al.
    Transient expression vectors for functional genomics, quantification of promoter activity and RNA silencing in plants.
    Plant Methods, 2005. 1: p. 13
    [PMID:16359558]